General Information

  • ID:  hor004535
  • Uniprot ID:  P56469
  • Protein name:  Cortistatin-14
  • Gene name:  Cort
  • Organism:  Mus musculus (Mouse)
  • Family:  Somatostatin family
  • Source:  animal
  • Expression:  Not induced by kainate. |Expressed in a subset of GABAergic cells in the cortex and hippocampus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0030334 regulation of cell migration; GO:0045187 regulation of circadian sleep/wake cycle, sleep
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  PCKNFFWKTFSSCK
  • Length:  14(96-109)
  • Propeptide:  MMGGRGTGGKWPSAFGLLLLWGVAASALPLESGPTGQDSVQEATEGRSGLLTFLAWWHEWASQASSSTPVGGGTPGLSKSQERPPPQQPPHLDKKPCKNFFWKTFSSCK
  • Signal peptide:  MMGGRGTGGKWPSAFGLLLLWGVAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibit the release of somatotropin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45701
  • Structure ID:  AF-P56469-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004535_AF2.pdbhor004535_ESM.pdb

Physical Information

Mass: 195508 Formula: C81H115N19O19S2
Absent amino acids: ADEGHILMQRVY Common amino acids: FK
pI: 9.67 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 4
Hydrophobicity: -47.14 Boman Index: -1883
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 0
Instability Index: 3902.14 Extinction Coefficient cystines: 5625
Absorbance 280nm: 432.69

Literature

  • PubMed ID:  NA
  • Title:  NA